Bcl 7A (BCL7A) Rabbit Polyclonal Antibody

CAT#: TA344744

Rabbit Polyclonal Anti-BCL7A Antibody

Product Images

WB Suggested Anti-BCL7A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Lung

• 

  Host: Rabbit; Target Name: BCL7A; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: BCL7A; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BCL7A antibody: synthetic peptide directed towards the middle region of human BCL7A. Synthetic peptide located within the following region: CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: B-cell CLL/lymphoma 7A
• Database Link:
  NP_066273
  Entrez Gene 605 Human
  UniProt ID Q4VC05
• Background: This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: BCL7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 86%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome