Antibodies for $/€ 289

Jump to Filters
View as table Download
Antithrombin III (SERPINC1) Rabbit Polyclonal Antibody
TA346038

USD 475.00

5 Days

Rabbit Polyclonal Anti-SERPINC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD
Antithrombin III (SERPINC1) Rabbit Polyclonal Antibody
TA346039

USD 475.00

5 Days

Rabbit Polyclonal Anti-Serpinc1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV