Antithrombin III (SERPINC1) Rabbit Polyclonal Antibody

CAT#: TA346039

Rabbit Polyclonal Anti-Serpinc1 Antibody

Product Images

WB Suggested Anti-Serpinc1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: serpin family C member 1
• Database Link:
  NP_000479
  Entrez Gene 11905 Mouse
  UniProt ID P01008
• Background: Serpinc1 is the most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin.
• Synonyms: AT3; AT3D; ATIII; THPH7
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%; Sheep: 92%; Bovine: 92%; Rabbit: 92%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Complement and coagulation cascades