Antithrombin III (SERPINC1) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
USD 665.00
Other products for "SERPINC1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 52 kDa |
| Gene Name | serpin family C member 1 |
| Database Link | |
| Background | Serpinc1 is the most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin. |
| Synonyms | AT3; AT3D; ATIII; THPH7 |
| Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%; Sheep: 92%; Bovine: 92%; Rabbit: 92% |
| Reference Data | |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Complement and coagulation cascades |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China