Antibodies for $/€ 289

Jump to Filters
View as table Download
epsilon Tubulin (TUBE1) Rabbit Polyclonal Antibody
TA345046

USD 475.00

5 Days

Rabbit Polyclonal Anti-TUBE1 Antibody - middle region

Applications IHC, WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA
Triosephosphate isomerase (TPI1) Rabbit Polyclonal Antibody
TA346536

USD 475.00

5 Days

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID