Triosephosphate isomerase (TPI1) Rabbit Polyclonal Antibody

CAT#: TA346536

Rabbit Polyclonal Anti-TPI1 Antibody

Product Images

WB Suggested Anti-TPI1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  HEPG2, Drosophila

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Drosophila, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: triosephosphate isomerase 1
• Database Link:
  NP_000356
  Entrez Gene 7167 Human
  UniProt ID P60174
• Background: This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate (G3P) and dihydroxy-acetone phosphate (DHAP) in glycolysis and gluconeogenesis. Mutations in this gene are associated with triosephosphate isomerase deficiency. Pseudogenes have been identified on chromosomes 1, 4, 6 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
• Synonyms: HEL-S-49; TIM; TPI; TPID
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Dog: 79%; Pig: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Pathways: Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Inositol phosphate metabolism, Metabolic pathways