Antibodies for $/€ 289

Jump to Filters
View as table Download
ESRP2 Rabbit Polyclonal Antibody
TA343935

USD 475.00

5 Days

Rabbit Polyclonal Anti-RBM35B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of human RBM35B. Synthetic peptide located within the following region: ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ