Antibodies for $/€ 289

Jump to Filters
View as table Download
STK38 Rabbit Polyclonal Antibody
TA346762

USD 475.00

5 Days

Rabbit Polyclonal Anti-STK38 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK38 antibody: synthetic peptide directed towards the C terminal of human STK38. Synthetic peptide located within the following region: IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD