STK38 Rabbit Polyclonal Antibody

CAT#: TA346762

Rabbit Polyclonal Anti-STK38 Antibody

Product Images

WB Suggested Anti-STK38 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate.There is BioGPS gene expression data showing that STK38 is expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STK38 antibody: synthetic peptide directed towards the C terminal of human STK38. Synthetic peptide located within the following region: IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: serine/threonine kinase 38
• Database Link:
  NP_009202
  Entrez Gene 11329 Human
  UniProt ID Q15208
• Background: STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.
• Synonyms: NDR; NDR1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase