Antibodies for $/€ 289

Jump to Filters
View as table Download
Profilin 1 (PFN1) Rabbit Polyclonal Antibody
TA346593

USD 475.00

5 Days

Rabbit Polyclonal Anti-PFN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL