Profilin 1 (PFN1) Rabbit Polyclonal Antibody

CAT#: TA346593

Rabbit Polyclonal Anti-PFN1 Antibody

Product Images

WB Suggested Anti-PFN1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

• 

  Lanes: 1. 20 ug human pregnant uterine muscle cells + hormone 2. 20 ug human pregnant uterine muscle cells - hormone; Primary Antibody Dilution: 1: 2000; Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680; Secondary Antibody Dilution: 1: 25, 000; Gene Name: PFN1;

• 

  Lanes: 1. 20 ug murine non-pregnant uteria tissue 2. 20 ug murine non-laboring uterine tissue 3. 20 ug murine laboring uterine tissue 4. 20 ug murine preterm laboring uterine tissue; Primary Antibody Dilution: 1: 2000; Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680; Secondary Antibody Dilution: 1: 25, 000; Gene Name: PFN1;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: profilin 1
• Database Link:
  NP_005013
  Entrez Gene 18643 MouseEntrez Gene 5216 Human
  UniProt ID P07737
• Background: This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. [provided by RefSeq, Jul 2012]
• Synonyms: ALS18
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 91%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Regulation of actin cytoskeleton