Profilin 1 (PFN1) (NM_005022) Human Recombinant Protein
CAT#: TP302338
Recombinant protein of human profilin 1 (PFN1)
View other "PFN1" proteins (3)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202338 protein sequence
Red=Cloning site Green=Tags(s) MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQK CSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | Pull-down assay (PMID: 27991922) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005013 |
| Locus ID | 5216 |
| UniProt ID | P07737 |
| Cytogenetics | 17p13.2 |
| Refseq Size | 1365 |
| Refseq ORF | 420 |
| Synonyms | ALS18 |
| Summary | This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China