Antibodies for $/€ 289

Jump to Filters
View as table Download
MFAP1 Rabbit Polyclonal Antibody
TA345166

USD 475.00

5 Days

Rabbit Polyclonal Anti-MFAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MFAP1 antibody: synthetic peptide directed towards the middle region of human MFAP1. Synthetic peptide located within the following region: TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT