Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL |
Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLL |
Rabbit Polyclonal Anti-AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN |
Rabbit Polyclonal Anti-AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the C terminal of human AKR1B1. Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI |
Rabbit Polyclonal Anti-LIPF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF. Synthetic peptide located within the following region: ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH |
Germany
Japan
United Kingdom
China
