ALDH1B1 Rabbit Polyclonal Antibody

CAT#: TA344350

Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region

Product Images

WB Suggested Anti-ALDH1B1 Antibody ; Positive Control: Lane 1: 30ug human hepatocytes; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti-rabbit-HRP; Secondry Antibody Dilution : 1:5000; Submitted by: Takeshi Saito, USC Keck School of Medicine

• 

  WB Suggested Anti-ALDH1B1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysateALDH1B1 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: aldehyde dehydrogenase 1 family member B1
• Database Link:
  NP_000683
  Entrez Gene 219 Human
  UniProt ID P30837
• Background: ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
• Synonyms: ALDH5; ALDHX
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 91%; Pig: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 85%; Guinea pig: 85%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Arginine and proline metabolism, Ascorbate and aldarate metabolism, beta-Alanine metabolism, Butanoate metabolism, Fatty acid metabolism, Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Histidine metabolism, Limonene and pinene degradation, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Tryptophan metabolism, Valine, leucine and isoleucine degradation