Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
Rabbit Polyclonal Anti-PPP2R5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ |
Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL |
Rabbit Polyclonal Anti-PPP2R5C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C. Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R5E antibody: synthetic peptide directed towards the N terminal of human PPP2R5E. Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK |
Germany
Japan
United Kingdom
China
