Rabbit Polyclonal Anti-SQLE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
Rabbit Polyclonal Anti-LSS Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSS antibody: synthetic peptide directed towards the N terminal of human LSS. Synthetic peptide located within the following region: TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGL |
Rabbit Polyclonal Anti-LSS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSS antibody: synthetic peptide directed towards the middle region of human LSS. Synthetic peptide located within the following region: KCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSE |
Rabbit Polyclonal Anti-FDFT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FDFT1 antibody: synthetic peptide directed towards the N terminal of human FDFT1. Synthetic peptide located within the following region: HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM |
Germany
Japan
United Kingdom
China
