Squalene Epoxidase (SQLE) Rabbit Polyclonal Antibody

CAT#: TA346342

Rabbit Polyclonal Anti-SQLE Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of squalene epoxidase (SQLE)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "SQLE"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name squalene epoxidase
Background Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.
Synonyms FLJ30795
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 86%; Zebrafish: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, Steroid biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.