Antibodies for $/€ 289

Jump to Filters
View as table Download
SCY1 like 3 (SCYL3) Rabbit Polyclonal Antibody
TA344608

USD 475.00

5 Days

Rabbit Polyclonal Anti-SCYL3 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Scyl3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC