SCY1 like 3 (SCYL3) Rabbit Polyclonal Antibody

CAT#: TA344608

Rabbit Polyclonal Anti-SCYL3 Antibody - middle region

Product Images

WB Suggested Anti-Scyl3 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Scyl3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: SCY1 like pseudokinase 3
• Database Link:
  NP_065156
  Entrez Gene 57147 Human
  UniProt ID Q8IZE3
• Background: Scyl3 may play a role in regulating cell adhesion/migration complexes in migrating cells.
• Synonyms: PACE-1; PACE1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase