Rabbit Polyclonal Anti-SCYL3 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Scyl3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC |
Rabbit Polyclonal Anti-SCYL3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCYL3 antibody: synthetic peptide directed towards the N terminal of human SCYL3. Synthetic peptide located within the following region: MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV |
Rabbit polyclonal antibody to SCY1 like 3 (SCY1-like 3 (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 80 and 549 of SCY1 like 3 (Uniprot ID#Q8IZE3) |
Carrier-free (BSA/glycerol-free) SCYL3 mouse monoclonal antibody, clone OTI7E7 (formerly 7E7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Anti-SCYL3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-SCYL3 mouse monoclonal antibody, clone OTI7E7 (formerly 7E7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SCYL3 mouse monoclonal antibody, clone OTI7E7 (formerly 7E7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-SCYL3 mouse monoclonal antibody, clone OTI7E7 (formerly 7E7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-SCYL3 mouse monoclonal antibody, clone OTI7E7 (formerly 7E7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Anti-SCYL3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Anti-SCYL3 mouse monoclonal antibody, clone OTI4F10 (formerly 4F10)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
