SCY1 like 3 (SCYL3) Rabbit Polyclonal Antibody

CAT#: TA344609

Rabbit Polyclonal Anti-SCYL3 Antibody - N-terminal region

Product Images

WB Suggested Anti-SCYL3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: COLO205 cell lysateSCYL3 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCYL3 antibody: synthetic peptide directed towards the N terminal of human SCYL3. Synthetic peptide located within the following region: MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: SCY1 like pseudokinase 3
• Database Link:
  NP_851607
  Entrez Gene 57147 Human
  UniProt ID Q8IZE3
• Background: SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.
• Synonyms: PACE-1; PACE1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase