Rabbit Polyclonal Anti-EPS8L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPS8L1 antibody: synthetic peptide directed towards the middle region of human EPS8L1. Synthetic peptide located within the following region: LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG |
Rabbit Polyclonal Anti-EPS8L1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPS8L1 antibody: synthetic peptide directed towards the N terminal of human EPS8L1. Synthetic peptide located within the following region: QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE |
Germany
Japan
United Kingdom
China
