EPS8L1 Rabbit Polyclonal Antibody

CAT#: TA344143

Rabbit Polyclonal Anti-EPS8L1 Antibody

Product Images

WB Suggested Anti-EPS8L1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: EPS8L1; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: EPS8L1; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: EPS8L1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: EPS8L1; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; There is BioGPS gene expression data showing that EPS8L1 is expressed in Jurkat

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EPS8L1 antibody: synthetic peptide directed towards the middle region of human EPS8L1. Synthetic peptide located within the following region: LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: EPS8 like 1
• Database Link:
  NP_060199
  Entrez Gene 54869 Human
  UniProt ID Q8TE68
• Background: EPS8L1 a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. This gene encodes a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. At least two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: DRC3; EPS8R1; PP10566
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome