Rabbit Polyclonal Anti-EPS8L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPS8L1 antibody: synthetic peptide directed towards the middle region of human EPS8L1. Synthetic peptide located within the following region: LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG |
Rabbit Polyclonal Anti-EPS8L1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPS8L1 antibody: synthetic peptide directed towards the N terminal of human EPS8L1. Synthetic peptide located within the following region: QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE |
EPS8L1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human EPS8L1 |
EPS8L1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ES8L1 |
Germany
Japan
United Kingdom
China
