Antibodies for $/€ 289

Jump to Filters
View as table Download
COUP TF1 (NR2F1) Rabbit Polyclonal Antibody
TA346488

USD 475.00

5 Days

Rabbit Polyclonal Anti-NR2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the C terminal of human NR2F1. Synthetic peptide located within the following region: VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP