COUP TF1 (NR2F1) Rabbit Polyclonal Antibody

CAT#: TA346488

Rabbit Polyclonal Anti-NR2F1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Recombinant protein of human nuclear receptor subfamily 2, group F, member 1 (NR2F1)
    • 20 ug

USD 823.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "NR2F1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the C terminal of human NR2F1. Synthetic peptide located within the following region: VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name nuclear receptor subfamily 2 group F member 1
Background The protein encoded by this gene is a nuclear hormone receptor and transcriptional regulator. The encoded protein acts as a homodimer and binds to 5'-AGGTCA-3' repeats. Defects in this gene are a cause of Bosch-Boonstra optic atrophy syndrome (BBOAS). [provided by RefSeq, Apr 2014]
Synonyms BBOAS; BBSOAS; COUP-TFI; EAR-3; EAR3; ERBAL3; NR2F2; SVP44; TCFCOUP1; TFCOUP1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 86%; Sheep: 86%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.