Antibodies for $/€ 289

Jump to Filters
View as table Download
CDC25B Rabbit Polyclonal Antibody
TA346010

USD 475.00

5 Days

Rabbit Polyclonal Anti-Cdc25b Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK