CDC25B Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1
USD 436.00
Other products for "CDC25B"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 65 kDa |
| Gene Name | cell division cycle 25B |
| Database Link | |
| Background | Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. It is required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner and directly dephosphorylates CDK1 and stimulates its kinase activity. |
| Synonyms | cell division cycle 25 homolog B (S. pombe); cell division cycle 25B; OTTHUMP00000030137; OTTHUMP00000030138; OTTHUMP00000030139 |
| Note | Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79% |
| Reference Data | |
| Protein Families | Druggable Genome, Phosphatase |
| Protein Pathways | Cell cycle, MAPK signaling pathway, Progesterone-mediated oocyte maturation |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China