CDC25B Rabbit Polyclonal Antibody

CAT#: TA346010

Rabbit Polyclonal Anti-Cdc25b Antibody

Product Images

Host: Rabbit; Target Name: Cdc25b; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: cell division cycle 25B
• Database Link:
  NP_068659
  Entrez Gene 12531 Mouse
  UniProt ID P30305
• Background: Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. It is required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner and directly dephosphorylates CDK1 and stimulates its kinase activity.
• Synonyms: cell division cycle 25 homolog B (S. pombe); cell division cycle 25B; OTTHUMP00000030137; OTTHUMP00000030138; OTTHUMP00000030139
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Cell cycle, MAPK signaling pathway, Progesterone-mediated oocyte maturation