Antibodies for $/€ 289

Jump to Filters
View as table Download
STAMBPL1 Rabbit Polyclonal Antibody
TA344761

USD 475.00

5 Days

Rabbit Polyclonal Anti-STAMBPL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAMBPL1 antibody: synthetic peptide directed towards the N terminal of human STAMBPL1. Synthetic peptide located within the following region: MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR