Germany
Japan
United Kingdom
China
STAMBPL1 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (3)
Recombinant protein of human STAM binding protein-like 1 (STAMBPL1)
USD 823.00
Other products for "STAMBPL1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-STAMBPL1 antibody: synthetic peptide directed towards the N terminal of human STAMBPL1. Synthetic peptide located within the following region: MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 50 kDa |
| Gene Name | STAM binding protein like 1 |
| Database Link | |
| Background | STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.STAMBPL1 does not cleave 'Lys-48'-linked polyubiquitin chains. |
| Synonyms | ALMalpha; AMSH-FP; AMSH-LP; bA399O19.2 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93% |
| Reference Data | |
| Protein Families | Druggable Genome, Protease |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.