STAMBPL1 (NM_020799) Human Recombinant Protein

CAT#: TP301884

Recombinant protein of human STAM binding protein-like 1 (STAMBPL1)

Product Images

Coomassie blue staining of purified STAMBPL1 protein (Cat# TP301884). The protein was produced from HEK293T cells transfected with STAMBPL1 cDNA clone (Cat# RC201884) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201884 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMERMASVYLEEGN
  LENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKNDLLKKYNVEYQEYLQSK
  NKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSA
  LSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFL
  QLAESNTVRGIETCGILCGKLTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHP
  TQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
  KHVLVKDIKIIVLDLR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065850
• Locus ID: 57559
• UniProt ID: Q96FJ0
• Cytogenetics: 10q23.31
• Refseq Size: 2094
• Refseq ORF: 1308
• Synonyms: ALMalpha; AMSH-FP; AMSH-LP; bA399O19.2
• Summary: Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Protease