Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-USP36 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP36 antibody: synthetic peptide directed towards the N terminal of human USP36. Synthetic peptide located within the following region: SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV

Rabbit Polyclonal Anti-USP36 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-USP36 antibody is: synthetic peptide directed towards the N-terminal region of Human USP36. Synthetic peptide located within the following region: KLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEA