USP36 Rabbit Polyclonal Antibody

CAT#: TA344663

Rabbit Polyclonal Anti-USP36 Antibody - N-terminal region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of ubiquitin specific peptidase 36 (USP36)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "USP36"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-USP36 antibody: synthetic peptide directed towards the N terminal of human USP36. Synthetic peptide located within the following region: SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 123 kDa
Gene Name ubiquitin specific peptidase 36
Background Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP36 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).
Synonyms DUB1
Note Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Dog: 85%; Horse: 77%
Reference Data
Protein Families Druggable Genome, Protease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.