Rabbit Polyclonal Anti-USP36 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP36 antibody: synthetic peptide directed towards the N terminal of human USP36. Synthetic peptide located within the following region: SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV |
Rabbit Polyclonal Anti-USP36 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-USP36 antibody is: synthetic peptide directed towards the N-terminal region of Human USP36. Synthetic peptide located within the following region: KLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEA |
Rabbit polyclonal anti-USP36 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human USP36. |
Carrier-free (BSA/glycerol-free) USP36 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USP36 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human USP36 (NP_079366.3). |
| Modifications | Unmodified |
USD 420.00
2 Weeks
USP36 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USP36 mouse monoclonal antibody,clone 2F1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USP36 mouse monoclonal antibody,clone 2F1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USP36 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
