Antibodies for $/€ 289

Jump to Filters
View as table Download
STK3 Rabbit Polyclonal Antibody
TA346751

USD 410.00

5 Days

Rabbit Polyclonal Anti-STK3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ
STK3 Rabbit Polyclonal Antibody
TA346750

USD 475.00

5 Days

Rabbit Polyclonal Anti-STK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-STK3 antibody: synthetic peptide directed towards the N terminal of human STK3. Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG