STK3 Rabbit Polyclonal Antibody

CAT#: TA346750

Rabbit Polyclonal Anti-STK3 Antibody

Product Images

Lanes: Lane 1: 30ug of HeLa cell lysate; Lane 2: 30ug of 293T cell lysate; Primary Antibody Dilution: 1: 2000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: STK3;

• 

  Lanes: Lane 1: 100ug untransfected COS-7 lysate; Lane 2: 100ug mock transfected Cos-7 lysate; Lane 3: 100ug STK3 transfected Cos-7 lysate; Lane 4: 50 ug STK3 transfected Cos-7 lysate; Lane 5: 25 ug STK3 transfected Cos-7 lysate; Primary Antibody Dilution: 1: 2000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: STK3;

• 

  Lanes: Lane 1: 100ug untransfected RPE-1 lysate; Lane 2: 100ug untransfected RPE-1 lysate; Lane 3: 100ug STK3 induced RPE-1 lysate; Lane 4: 100ug STK3 induced RPE-1 lysate; Primary Antibody Dilution: 1: 2000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: STK3;

• 

  WB Suggested Anti-STK3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STK3 antibody: synthetic peptide directed towards the N terminal of human STK3. Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: serine/threonine kinase 3
• Database Link:
  NP_006272
  Entrez Gene 56274 MouseEntrez Gene 6788 Human
  UniProt ID Q13188
• Background: This gene encodes a serine/threonine protein kinase activated by proapoptotic molecules indicating the encoded protein functions as a growth suppressor. Cleavage of the protein product by caspase removes the inhibitory C-terminal portion. The N-terminal portion is transported to the nucleus where it homodimerizes to form the active kinase which promotes the condensation of chromatin during apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
• Synonyms: KRS1; MST2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Horse: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: MAPK signaling pathway