Antibodies for $/€ 289

Jump to Filters
View as table Download
FOXP4 Rabbit Polyclonal Antibody
TA345501

USD 410.00

5 Days

Rabbit Polyclonal Anti-FOXP4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the C terminal of human FOXP4. Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE
FOXP4 Rabbit Polyclonal Antibody
TA345500

USD 475.00

5 Days

Rabbit Polyclonal Anti-FOXP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the N terminal of human FOXP4. Synthetic peptide located within the following region: MVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGAD