FOXP4 Rabbit Polyclonal Antibody

CAT#: TA345501

Rabbit Polyclonal Anti-FOXP4 Antibody

Product Images

WB Suggested Anti-FOXP4 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 62500; Positive Control: Raji cell lysate

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the C terminal of human FOXP4. Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: forkhead box P4
• Database Link:
  NP_612466
  Entrez Gene 116113 Human
  UniProt ID Q8IVH2
• Background: FOXP4 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. FOXP4 may play a role in the development of tumors of the kidney and larynx.This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.
• Synonyms: hFKHLA
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Mouse: 91%; Rat: 90%; Dog: 86%; Bovine: 86%; Guinea pig: 82%

Reference Data

• Protein Families: Transcription Factors