Rabbit Polyclonal Anti-OVOL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OVOL2 antibody: synthetic peptide directed towards the N terminal of human OVOL2. Synthetic peptide located within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG |
Rabbit Polyclonal Anti-OVOL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OVOL2 antibody: synthetic peptide directed towards the middle region of human OVOL2. Synthetic peptide located within the following region: QEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK |
Germany
Japan
United Kingdom
China