OVOL2 Rabbit Polyclonal Antibody

CAT#: TA345333

Rabbit Polyclonal Anti-OVOL2 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of ovo-like 2 (Drosophila) (OVOL2)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "OVOL2"

Specifications

Product Data
Applications WB
Recommended Dilution WB, IF
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-OVOL2 antibody: synthetic peptide directed towards the middle region of human OVOL2. Synthetic peptide located within the following region: QEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name ovo like zinc finger 2
Background OVOL2 contains 4 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family. It is a DNA-binding protein that binds to the 5'-G[GCT]GGGGG-3' core sequence. Probably acts as a transcription regulator.
Synonyms EUROIMAGE566589; ZNF339
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.