Rabbit Polyclonal Anti-PNRC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNRC2 antibody: synthetic peptide directed towards the middle region of human PNRC2. Synthetic peptide located within the following region: NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN |
Rabbit Polyclonal Anti-PNRC2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pnrc2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN |
Germany
Japan
United Kingdom
China