PNRC2 Rabbit Polyclonal Antibody

CAT#: TA344968

Rabbit Polyclonal Anti-PNRC2 Antibody - N-terminal region

Product Images

WB Suggested Anti-Pnrc2 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pnrc2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: proline rich nuclear receptor coactivator 2
• Database Link:
  NP_060231
  Entrez Gene 100125373 Rat
  UniProt ID Q9NPJ4
• Background: Pnrc2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. It may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. It is required for UPF1/RENT1 localization to the P-body.It also acts as a nuclear receptor coactivator. It may play a role in controlling the energy balance between energy storage and energy expenditure.
• Synonyms: FLJ20312; MGC99541
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors