Rabbit Polyclonal Anti-PNRC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNRC2 antibody: synthetic peptide directed towards the middle region of human PNRC2. Synthetic peptide located within the following region: NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN |
Rabbit Polyclonal Anti-PNRC2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pnrc2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN |
PNRC2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PNRC2 |
PNRC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNRC2 (NP_060231.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
