Antibodies for $/€ 289

Jump to Filters
View as table Download
CoREST (RCOR1) Rabbit Polyclonal Antibody
TA343771

USD 410.00

5 Days

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS
CoREST (RCOR1) Rabbit Polyclonal Antibody
TA343772

USD 475.00

5 Days

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the C terminal of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS