CoREST (RCOR1) Rabbit Polyclonal Antibody

CAT#: TA343772

Rabbit Polyclonal Anti-RCOR1 Antibody

Product Images

WB Suggested Anti-RCOR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Jurkat cell lysate; RCOR1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the C terminal of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: REST corepressor 1
• Database Link:
  NP_055971
  Entrez Gene 23186 Human
  UniProt ID Q9UKL0
• Background: RCOR1 is a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression. [supplied by OMIM]
• Synonyms: COREST; RCOR
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 92%; Bovine: 86%; Pig: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease