Rabbit Polyclonal Anti-SLC2A4RG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC2A4RG antibody is: synthetic peptide directed towards the N-terminal region of Human SLC2A4RG. Synthetic peptide located within the following region: MERPPPRAAGRDPSALRAEAPWLRAEGPGPRAAPVTVPTPPQGSSVGGGF |
Rabbit Polyclonal Anti-SLC2A4RG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC2A4RG antibody is: synthetic peptide directed towards the C-terminal region of Human SLC2A4RG. Synthetic peptide located within the following region: HSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKPRGDAKKCRKV |
Germany
Japan
United Kingdom
China