Rabbit Polyclonal Anti-TFB2M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFB2M antibody: synthetic peptide directed towards the N terminal of human TFB2M. Synthetic peptide located within the following region: MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQ |
Rabbit Polyclonal Anti-TFB2M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFB2M antibody: synthetic peptide directed towards the C terminal of human TFB2M. Synthetic peptide located within the following region: ATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKD |
Germany
Japan
United Kingdom
China