TFB2M Rabbit Polyclonal Antibody

CAT#: TA345362

Rabbit Polyclonal Anti-TFB2M Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein
    • 20 ug

USD 823.00


Transient overexpression lysate of transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "TFB2M"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TFB2M antibody: synthetic peptide directed towards the C terminal of human TFB2M. Synthetic peptide located within the following region: ATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name transcription factor B2, mitochondrial
Background TFB2M is a S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. It is also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. It stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.
Synonyms Hkp1; mtTFB2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.