Antibodies for $/€ 289

Jump to Filters
View as table Download
Apolipoprotein O (APOO) Rabbit Polyclonal Antibody
TA343927

USD 410.00

5 Days

Rabbit Polyclonal Anti-FAM121B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the N terminal of human FAM121B. Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL