Antibodies for $/€ 289

Jump to Filters
View as table Download
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA346157

USD 410.00

5 Days

Rabbit Polyclonal Anti-CYP2D6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the N terminal of human CYP2D6. Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
TA346158

USD 475.00

5 Days

Rabbit Polyclonal Anti-CYP2D6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the middle region of human CYP2D6. Synthetic peptide located within the following region: EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV